PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.859SE
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Trihelix
Protein Properties Length: 779aa    MW: 86642.5 Da    PI: 8.2306
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.859SEgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix64.81.9e-20686767186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ +e+++Li++r ++++r++  k +++lWee+s+ + + g++rsp qCk+ w +l ++y+++k+ +++  s  +s+++y++++e
  Aradu.859SE 686 KWKPEEIKKLINMRGKLHDRFQIVKGRMALWEEISQSLLADGISRSPGQCKSLWTSLVQKYQETKNEKGS--S--KSSWQYLEDME 767
                  7****************************************************************99998..3..446*******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.60.15.101.5E-6727277IPR001279Metallo-beta-lactamase
SuperFamilySSF562818.89E-6228400IPR001279Metallo-beta-lactamase
SMARTSM008492.0E-2440240IPR001279Metallo-beta-lactamase
PfamPF127067.1E-1051187IPR001279Metallo-beta-lactamase
PROSITE profilePS500907.921679743IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.7E-5681745IPR009057Homeodomain-like
PfamPF138379.3E-17684769No hitNo description
CDDcd122031.09E-20685750No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009942Biological Processlongitudinal axis specification
GO:0060918Biological Processauxin transport
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    Send to blast
MEGPRKSMED SVQRKMEQFY EGKDGPPLRV LPIGGLGEIG MNCMLVGNHD RYILIDAGVM  60
FPDYDELGVQ KIIPDTTFIR KWSHKIEALV ITHGHEDHIG ALPWVIPALD SNTPIFASSF  120
TMELIKKRLK EHGIFLPSRL KIFRTRKKFM AGPFEIEPIR VTHSIPDCCG LVLRCSDGTI  180
LHTGDWKIDE TPLDGKVFDR EALEELSKEG VTLMMSDSTN VLSPGRTISE SVVKDALLRH  240
ISASKGRVIT TQFASNLHRL GSVKAAADLT GRKLVFVGMS LRTYLDAAWK DGKAPIDPST  300
LVKAEDIDAY APKDLLIVTT GSQAEPRAAL NLASYGSSHA FKLTKEDIVL YSAKEEVLRI  360
VKPQHFLPIH GELLFLKEHE LLGKSNGIRH TAVIKNGEML GVSHLRNRRV LSNGFISLGR  420
ENLQLKYSDG DKAFGTSSDL FIDERLKIAL DGIIVVSMEV FRPQRAESLA ENTLNGKIRI  480
TTRCLWLDKG KLLDALHKAA HAALSSCPVK CPLAHMERTV AEVLRKMVRK YSGKRPEVIV  540
IAIENPAAVL AEEINTKLSG KSHVDHGTST LRKIVDGHGK ENQPDTTQIR VNAADANDVE  600
GLLPEEDTGP PTEEAEGDLS DSEEFWKPFI ASSPVEKSIK ANNGYVPRKE HKSNIKKDDS  660
EDIGEANFVK ASSSELKSSK SGKRNKWKPE EIKKLINMRG KLHDRFQIVK GRMALWEEIS  720
QSLLADGISR SPGQCKSLWT SLVQKYQETK NEKGSSKSSW QYLEDMEKIM PDSEAMATK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zq4_E2e-663046011473RIBONUCLEASE J 1
3zq4_D2e-663046011473RIBONUCLEASE J 1
3zq4_C2e-663046011473RIBONUCLEASE J 1
3zq4_A2e-663046011473RIBONUCLEASE J 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015937734.10.0PREDICTED: ribonuclease J-like
TrEMBLK7KL530.0K7KL53_SOYBN; Uncharacterized protein
STRINGGLYMA04G37020.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50993450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63420.10.0Trihelix family protein